PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK20924.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family CO-like
Protein Properties Length: 371aa    MW: 40289.9 Da    PI: 4.9267
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK20924.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.81.1e-084388342
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                ++C+ +e+ ++   C+ +   lC +C   +H+       H++vp+
  PK20924.1 43 VWVCEVCEQAPAAVTCKADAASLCVSCDADIHSAnplaqrHERVPV 88
               689*****************************66899999999986 PP

2CCT69.39.7e-24295338144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                Rea++lRYkeKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++
  PK20924.1 295 REARVLRYKEKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRT 338
                9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.011345IPR000315B-box-type zinc finger
CDDcd000211.18E-41145No hitNo description
PROSITE profilePS5011910.6234188IPR000315B-box-type zinc finger
PfamPF006437.5E-74288IPR000315B-box-type zinc finger
CDDcd000211.06E-84488No hitNo description
SMARTSM003362.7E-94688IPR000315B-box-type zinc finger
PfamPF062031.1E-17295337IPR010402CCT domain
PROSITE profilePS5101716.648295337IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
YQRRGLVTGS AAVFCRADSA FLCLSCDTKI HCANKLASRH ERVWVCEVCE QAPAAVTCKA  60
DAASLCVSCD ADIHSANPLA QRHERVPVEP FYDSTDSIVR SSAALNFFAV PASGACSDET  120
GGGACRNDEA SLPWMISNPN FDSKLMVAAT AAEEEEEPNV VVKSSTDNLF FSEMDSFLDF  180
DYSNTIHSSS ITDSVVPVKI KPNPPSSIVN NSENCFDIDF CRSKLSSFNY PAQCLSQSVS  240
SSSIDVGIVP DGNSISEISF SFGGSLNQNS STDPLPSISA STNSSEPTQL CGLDREARVL  300
RYKEKRKNRR FEKTIRYASR KAYAETRPRI KGRFAKRTET ETDLDLEPIY GSAAAAAAFI  360
AESQYGVVPT F
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015878976.11e-169PREDICTED: zinc finger protein CONSTANS-LIKE 5
SwissprotQ9FHH81e-112COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLW9RK131e-155W9RK13_9R
STRINGGLYMA13G01290.11e-142(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.11e-110CONSTANS-like 5